PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0257s0026.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 350aa    MW: 39543.4 Da    PI: 6.6275
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0257s0026.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.73.2e-3043100260
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           DgynWrKYGqK+vkg efprsYY+Ct+++C+vkk +er++ d++++e++Y+g+H h+k
  Kalax.0257s0026.2.p  43 TDGYNWRKYGQKHVKGCEFPRSYYKCTHPNCEVKKLLERAH-DGRITEVIYKGTHSHPK 100
                          6***************************************9.***************85 PP

2WRKY103.21.5e-32206264159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Ct +gCpv+k+ver+ +d k v++tYeg+Hnh+
  Kalax.0257s0026.2.p 206 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCPVRKHVERACHDIKSVITTYEGKHNHD 264
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.1E-2639101IPR003657WRKY domain
SuperFamilySSF1182907.19E-2442101IPR003657WRKY domain
SMARTSM007743.3E-3242100IPR003657WRKY domain
PROSITE profilePS5081122.35543101IPR003657WRKY domain
PfamPF031061.0E-234499IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.4E-37191266IPR003657WRKY domain
SuperFamilySSF1182904.71E-29198266IPR003657WRKY domain
PROSITE profilePS5081138.067201266IPR003657WRKY domain
SMARTSM007746.5E-37206265IPR003657WRKY domain
PfamPF031065.2E-25207264IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MDSQQFEIQS QRIEGEKAMP SATVSPSDQN DVRSSSLLDN SSTDGYNWRK YGQKHVKGCE  60
FPRSYYKCTH PNCEVKKLLE RAHDGRITEV IYKGTHSHPK PQSKRRFSND AAMGMTDEHL  120
ERFSYQSEEM ALNSQVATPD MDGTSELPSG PPSDEELNDD KYDDDGDDPN SKRRKQDMGI  180
THFISSVKPI REPRVVVQTV SEVDILDDGY RWRKYGQKVV KGNPNPRSYY KCTNPGCPVR  240
KHVERACHDI KSVITTYEGK HNHDVPSAKA SNQEAAAVDP YSGYTSNIGS SMQQNDSVTR  300
VSNHYHQRPP DVRNQYHLED NEGENFRFAT PYLSSNAYPQ NLGSLLMGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-3737267878Probable WRKY transcription factor 4
2lex_A1e-3737267878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010644520.11e-109PREDICTED: probable WRKY transcription factor 20
SwissprotQ93WV01e-100WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLF6HER41e-109F6HER4_VITVI; Putative uncharacterized protein
STRINGVIT_19s0090g01720.t011e-109(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.19e-99WRKY family protein